9zxz.comHome NavigationNavigation
Home >  Apps >  Video Players & Editors
Apps
  • NYX Music Player- Offline MP3
    NYX Music Player- Offline MP3

    Video Players & Editors 丨 57.75M

    DiscoverawholenewlevelofmusicexperiencewithNyxMusicPlayer.Boastingasleekandmoderninterface,thisprofessionalmusicplayerappofferstop-notchsoundqualityandanarrayoffeaturesforseamlessmusicplayback.Easilysearchforyourfavoritesongsusingtheintuitivesearchbar,whetherbysongtitle,artistname,oralbum.Createpers

    Download
  • Pixel+ – Music Player
    Pixel+ – Music Player

    Video Players & Editors 丨 10.10M

    Discovernewmusic,listentoyourfavoriteartists,andenjoyawiderangeofradioprogramsallinoneplacewithPixel+–MusicPlayer.Letthemusicimmerseyouinaworldofrelaxationandenjoyment,awayfromthestressesofeverydaylife.Whetheryou'reinthemoodformusic,podcasts,orradio,Pixel+–MusicPlayerhassomethingforeveryone.Takeadva

    Download
  • Omnia Music Player
    Omnia Music Player

    Video Players & Editors 丨 7.98M

    OmniaMusicPlayerwilltransportyoutoaworldofcaptivatingmelodiesandemotionallyrics.Withavastcollectionofsongssortedbyartistsandgenres,youcaneasilydiscovernewmusicthatresonateswithyoursoul.Thisappnotonlyprovideshigh-qualityaudiobutalsoallowsyoutocreatepersonalizedplayliststailoredtoyouruniquetaste.Wheth

    Download
  • Music Volume EQ - Equalizer
    Music Volume EQ - Equalizer

    Video Players & Editors 丨 11.30M

    MusicVolumeEQ+Equalizerisamust-haveappformusicloverswhowanttoenhancetheirlisteningexperience.Withtheabilitytoadjustvolume,balance,andsoundqualitywithanextensiveequalizer,userscancustomizetheirmusictosuittheirmoodandsurroundings.Theappalsooffersmultiplesoundmodesfordifferentgenres,allowinguserstocrea

    Download
  • Vlog video editor maker: VlogU
    Vlog video editor maker: VlogU

    Video Players & Editors 丨 46.13M

    Lookingtoupyourvlogginggameorcreateengagingvideosofyourdailylife?LooknofurtherthanVlogU!Thisuser-friendlyappsimplifiesthevideoeditingprocess,allowingyoutotrim,merge,andaddavarietyofvisualeffectswithjustafewsimplesteps.Customizeyourvideoswithawiderangeoffilters,transitions,andstickerstomakethemmoreca

    Download
  • Boom: Bass Booster & Equalizer
    Boom: Bass Booster & Equalizer

    Video Players & Editors 丨 33.90M

    Boom:MusicPlayerisoneofthebestapps.Itsadvancedfeatures,user-friendlyinterface,andpowerfultoolsmakeitstandoutamongothermusicappsonthemarket.Withamodernequalizer,3Dsurroundsoundtechnology,accesstothousandsofradioandpodcaststations,andstreamingcompatibilitywithpopularmusicplatforms,thisapptransformsthe

    Download
  • Cricket Mazza 11 Live Line
    Cricket Mazza 11 Live Line

    Video Players & Editors 丨 18.00M

    StayuptodatewithallthingsCricketbyusingCricketMazza11LiveLine,theultimateappforfansofthisbelovedsport.Thisappallowsyoutofollowvarioustournamentsglobally,providinglivescores,matchupdates,andnotificationsforyourfavoriteleaguesandteams.Withauser-friendlyinterface,CricketMazza11LiveLineoffersaplethoraof

    Download
  • Anime Music Radio
    Anime Music Radio

    Video Players & Editors 丨 15.40M

    DiscoverawholenewworldofanimemusicwiththeAnimeMusicRadioapp.Withnearly100radiostationsatyourfingertips,thisappisatreasuretroveofallyourfavoriteanimetunes,fromOSTstoJ-POPandJ-ROCK.Thehigh-qualityaudioexperience,poweredbythelicensedBASS©audiolibrary,ensurescrystal-clearsoundwitha10-bandequalizerforper

    Download
  • Audials Radio Pro
    Audials Radio Pro

    Video Players & Editors 丨 12.20M

    DiscoverawholenewworldofmusicwithAudialsRadioPro!Thismusicplayerallowsyoutocreateuniqueplaylistsfilledwithcatchymelodiesanddeeplyrics,givingyoutheopportunitytoimmerseyourselfinawidevarietyofsongs.Withover100radiostationsand260podcasts,youcanchoosefromavastselectionoftunesfromdifferentgenressuchaspop

    Download
  • Voice Recorder & Voice Memos
    Voice Recorder & Voice Memos

    Video Players & Editors 丨 10.46M

    Withtheabilitytorecordimportantconversations,lectures,seminars,andcreatevoicenotes,thisappisessentialformanagingworkandgeneratingideas.VoiceRecorder&VoiceMemos'sdetailedrecordingcapabilitiesensurecrystalclearaudioquality,whiletheeditingfeaturesallowuserstocustomizetheirrecordingsforbetterorganizatio

    Download
  • Ringtones for Android™
    Ringtones for Android™

    Video Players & Editors 丨 34.29M

    WithRingtonesforAndroid,youcantransformyourphoneintoapersonalizedaudioandvisualmasterpiece.Browsethroughthousandsofringtones,alarmsounds,SMSnotifications,andlivewallpaperstocreateaphoneexperiencethatreflectsyouruniquestyleandtaste.Thisappoffersanever-endingmusiclibrary,avarietyofsoundstylestochoosef

    Download
  • Radio France : radios, podcast
    Radio France : radios, podcast

    Video Players & Editors 丨 17.40M

    ElevateyourlisteningexperiencewiththeRadioFrance:radios,podcastapp,whereyoucantuneintoliveradioandimmerseyourselfinaworldofpodcastsfromtopstationslikeFranceInter,FranceCulture,FranceMusique,andmore.Whetheryou'reintoclassical,jazz,rap,orpop,thisapphasgotyoucoveredwithavastarrayofmusicgenrestoexplore.

    Download
  • Folder Player Pro
    Folder Player Pro

    Video Players & Editors 丨 4.43M

    Thisappallowsuserstodiveintoaworldofcaptivatingsongs,eachwithdeepandmeaningfullyrics.Withavastmusiclibrarythatisconstantlyupdated,userscaneasilyexploreanddiscovernewmusicthatsuitstheirtaste.FolderPlayerProstandsoutfromothermusicplayerappswithitsabilitytoorganizemusicfilesintoseparatefoldersbasedonge

    Download
  • Lyrics & Chords : Nepali
    Lyrics & Chords : Nepali

    Video Players & Editors 丨 5.80M

    DiscovertheultimatetoolforallNepalimusicenthusiastswithLyrics&Chords:Nepali.ThisappprovidesyouwiththelyricsandchordsforyourfavoriteNepalisongs,completewithbeatandstrumpattern.Withfeatureslikechorddiagrams,colorchangeablechords,andchordtransposetoallscales,thisappisperfectforbothbeginnersandexperienc

    Download
  • HiMusic: music player no wifi
    HiMusic: music player no wifi

    Video Players & Editors 丨 20.00M

    HiMusic:musicplayernowifiisyourgotomusicplayerappthatallowsyoutoenjoymusicandvideosforfree,evenoffline.Withavibranthomepagethatwillliftyourmood,HiMusic:musicplayernowifioffersawiderangeofmusicstylesfromthelatesthitstolocalfavorites.Searchforyourfavoritesongsquicklyandeasily,createyourownplaylists,an

    Download
  • Offline Music Player: My Music
    Offline Music Player: My Music

    Video Players & Editors 丨 25.50M

    OfflineMusicPlayer:MyMusicistheultimatemusicappforthosewhowanttolistentotheirfavoritetuneswithoutanyinternetconnection.Withawiderangeofthemesandtoptrendingsongsfromfamousartistsworldwide,thisappallowsyoutodownloadandstoreyourfavoritemusicforofflinelistening.Notonlycanyouenjoyuninterruptedplaybackand

    Download
  • TNT Sports: News & Results
    TNT Sports: News & Results

    Video Players & Editors 丨 57.60M

    StayintheloopwithallthingssportsbydownloadingtheTNTSports:News&Resultsapp!Getaccesstothelatestheadlines,stats,highlights,andexpertcommentaryonfootball,boxing,UFC,rugby,andmore.Nevermissagamewithlivematchupdatesandtransfernewsforallthetopfootballleagues.StayuptodateonrugbyeventslikePremiershipRugbyan

    Download
  • Rádio Positiva FM
    Rádio Positiva FM

    Video Players & Editors 丨 76.00M

    StepintotheworldofcountrymusicwiththeinnovativeanduniquelydesignedRádioPositivaFMapp,whereyoucanstayupdatedonallthingscountry.Withafocusonbeinginfluentialandauthentic,thisappisyourgo-todestinationforallthingscountrymusic.Fromthelatesthitstoclassicfavorites,youcantuneinanytimetolistentothebestofcount

    Download
  • UVX Player Pro
    UVX Player Pro

    Video Players & Editors 丨 82.30M

    UVXPlayerProistheultimatemultimediaplayerthatoffersaseamlessandenjoyablevideoviewingexperienceforusersonthego.ExperiencethepowerandconvenienceofUVXPlayerProtodayandelevateyourvideowatchingexperiencetonewheights!FeaturesofUVXPlayerPro:Wideformatsupport:UVXPlayerProcanplaypopularvideoformatslikeMPAVI,

    Download
  • Música Norteña Mexicana
    Música Norteña Mexicana

    Video Players & Editors 丨 42.00M

    Introducingournewfreenorteñomusicapp,MúsicaNorteñaMexicana,theultimatedestinationforallfansofthislivelygenre.Diveintoavastcollectionofnorteñomusic,rangingfromthebelovedclassicstothelatesthits,allatyourfingertips.Ouruser-friendlyinterfaceallowsyoutoeasilynavigatethroughtheapp,createpersonalizedplayli

    Download
  • TIDAL Music: HiFi sound
    TIDAL Music: HiFi sound

    Video Players & Editors 丨 89.80M

    ElevateyourmusiclisteningexperiencewithTIDALMusic,apremiumunlockedappthatoffersthehighestqualitysoundcustomizationsforusers.Saygoodbyetoordinarysoundsandhellotogreatonesasyouimmerseyourselfinyourfavoritetuneswithtop-notchaudioquality.Whetheryou'relookingtounwindafterabusydayorjustwanttoenhanceyourmu

    Download
  • Alkitab audio
    Alkitab audio

    Video Players & Editors 丨 15.80M

    Introducing a new app that brings the Holy Bible to your fingertips in Indonesian! With the Alkitab audio app, Android users can now access the complete Alkitab Terjemahan Baru, containing both the Old and New Testament, online and offline. This user-friendly app offers high-quality audio, a simple

    Download
  • Ritam - ऋतम्
    Ritam - ऋतम्

    Video Players & Editors 丨 21.80M

    DiscoveraworldofknowledgeandinformationatyourfingertipswithRitam-ऋतम्.Thisinnovativeappisyourone-stopdestinationforallthingsrelatedtoreading,learning,andsharing.Diveintoadiversearrayoftopicsthrougharticles,blogs,andmore,andexpandyourhorizonswitheverytap.Stayconnectedwiththelatesttrendsandinsights,an

    Download
  • English video songs - English Album Songs
    English video songs - English Album Songs

    Video Players & Editors 丨 6.80M

    Introducing the ultimate the English video songs - English Album Songs app! Get ready to dive into the world of famous English Video songs with this incredible app. It offers a wide range of hit songs from some of the biggest artists and bands out there. From Adele, Justin Bieber, and Beyonce to Br

    Download
  • Jazz & Blues Music Radio
    Jazz & Blues Music Radio

    Video Players & Editors 丨 15.28M

    Immerseyourselfintheworldofjazzandbluesmusicwiththeultimatestreamingexperience-Jazz&BluesMusicRadioAPP!Withalmost100radiostationstochoosefrom,youcanenjoyclassicjazz,mellowjazz,smoothjazz,saxophonejazz,andmorerightatyourfingertips.PoweredbyalicensedBASS©audiolibrary,thisappoffersincredible32-bitsound

    Download
  • Torrent Pro - Torrent Download
    Torrent Pro - Torrent Download

    Video Players & Editors 丨 13.20M

    Torrent Pro is your go-to application for efficient torrent management. As a powerful torrent downloader, it ensures rapid file downloads, outperforming many other torrent clients on the market. Experience seamless performance and enhanced speed with Torrent Pro, making your downloading tasks effor

    Download
  • Video Maker with Music & Photo
    Video Maker with Music & Photo

    Video Players & Editors 丨 56.18M

    Video Maker with Music & Photo is an incredible app that allows you to transform your ordinary photos into captivating short videos or GIFs. As soon as you open the app, you'll be greeted by a stunning collection of the latest effects and filters. With a wide range of categories like Trends, Celebra

    Download
  • YouCut - Video Editor & Maker
    YouCut - Video Editor & Maker

    Video Players & Editors 丨 25.10M

    YouCut - Video Editor & Maker is a free app designed for those who want to create stunning videos for social media. With a user-friendly full-screen editing experience, you can easily craft professional-looking videos without watermarks. Ideal for making photo slideshows or sharing special moments,

    Download
  • Zoro - Watch Anime SUB/DUB
    Zoro - Watch Anime SUB/DUB

    Video Players & Editors 丨 7.90M

    Enter the world of unlimited anime streaming with the official Zoro - Watch Anime SUB/DUB app! With a vast collection of genres ranging from action to romance, the app provides high-quality subbed and dubbed anime for all ages and preferences. Say goodbye to buffering and lagging as you dive into a

    Download
  • Channel 3000 | News 3 Now
    Channel 3000 | News 3 Now

    Video Players & Editors 丨 20.10M

    Stay up-to-date on all things happening in Madison and South-Central Wisconsin with Channel 3000 | News 3 Now app. From breaking news stories to live newscasts and weather updates, Channel 3000 | News 3 Now has you covered. Keep track of current weather conditions, storm alerts, and school closings

    Download
  • Instrumental Music
    Instrumental Music

    Video Players & Editors 丨 9.09M

    Discover the ultimate Instrumental Music app, bringing you the best songs from around the world. Immerse yourself in a variety of genres, including romantic, relaxing, Christian, classical, and happy music among others. With a wide selection of radio stations specialized in instrumental music, you c

    Download
  • Node Video - Pro Video Editor
    Node Video - Pro Video Editor

    Video Players & Editors 丨 124.69M

    Revolutionary audio reactorPower and flexibilityAI-Powered Magic helps separating human and background in real time3D renderersProfessional effects and presetsDiverse effects and propertiesConclusionNode Video is a revolutionary mobile video editing application that empowers users to unleash their c

    Download
  • Music Player - MP3 Player, Vid
    Music Player - MP3 Player, Vid

    Video Players & Editors 丨 10.00M

    Introducing VidAPP Music Player, the ultimate audio and video player app for Android! This easy-to-use and stylishly designed music player allows you to browse songs in various ways, including by album, playlist, artist, and genre. With its multi-theme feature, you can customize the look and feel of

    Download
  • atv - Canlı TV - Dizi İzle
    atv - Canlı TV - Dizi İzle

    Video Players & Editors 丨 36.48M

    Watch your favorite Turkish TV shows and stay updated with the latest news with the atv - Canlı TV - Dizi İzle application! With a user-friendly design tailored for atv viewers, you can easily access live broadcasts, exclusive videos, and trailers of upcoming series. From popular daytime programs t

    Download
  • Piano Companion PRO
    Piano Companion PRO

    Video Players & Editors 丨 16.80M

    Areyoupassionateaboutplayingthepianoandshowcasingyourskills?LooknofurtherthanPianoCompanionPRO!Thisappisperfectforpianoloversofalllevels,whetheryou'reaseasonedplayerorjuststartingout.Withawiderangeoffeaturesandtools,thisappallowsyoutoimmerseyourselfintheworldofmusic,createuniquetones,andlearnaboutdi

    Download
  • Anime HD Online -Anime TV Free
    Anime HD Online -Anime TV Free

    Video Players & Editors 丨 5.30M

    Dive into the world of anime with this amazing Anime HD Online -Anime TV Free app that provides access to a wide range of popular titles for free. With options to watch in both Sub and Dub with English subtitles, you can enjoy your favorite anime shows in stunning HD quality. Share your thoughts an

    Download
  • Photos To Video
    Photos To Video

    Video Players & Editors 丨 13.70M

    With the Photos To Video app, unleashing your creativity has never been easier! Transform your ordinary pictures into captivating MP4 videos that will impress everyone. Whether you want to use images from your gallery or snap new ones with your camera, the choice is yours. But that's not all – you

    Download
  • Go 123 Movies
    Go 123 Movies

    Video Players & Editors 丨 10.30M

    Get ready to enjoy a vast collection of old and new movies right at your fingertips with our app, Go 123 Movies! Watch full movies for free, no mandatory sign-up required, with fast streaming and no annoying interruptions. Easily navigate through our selection of public domain movies, beautifully p

    Download
  • AST Connect
    AST Connect

    Video Players & Editors 丨 78.70M

    AST Connect is a versatile mobile application designed specifically for customers of karaoke clubs equipped with the AST-250 karaoke system. This app simplifies the karaoke experience by allowing users to easily search for their favorite artists, titles, and lyrics. With the option to also submit s

    Download
  • V Art - Video Maker
    V Art - Video Maker

    Video Players & Editors 丨 8.37M

    Introducing V Art - Video Maker, the ultimate video editing and photo slideshow app. With this powerful and user-friendly tool, you can easily create stunning music videos and share your amazing video stories with friends and family. Whether you want to commemorate special occasions or simply captur

    Download
  • Animesuge - Watch Anime Free
    Animesuge - Watch Anime Free

    Video Players & Editors 丨 1.20M

    Animesuge is an online platform where users can watch anime for free. It offers a wide selection of anime series and movies across various genres, often with options for English subtitles and dubbing. The site typically features a user-friendly interface, making it easy to browse and discover new t

    Download
  • Brando Classic Old Time Radio
    Brando Classic Old Time Radio

    Video Players & Editors 丨 4.49M

    Step back in time and relive the golden age of radio with Brando Classic Old Time Radio. This exceptional app allows you to stream vintage radio shows, bringing a touch of nostalgia to your modern device. Dive into a carefully curated schedule that features thrilling mysteries every Thursday and exc

    Download
  • Adrenalina Gol
    Adrenalina Gol

    Video Players & Editors 丨 6.45M

    Adrenalina Gol APK is the ultimate Android app for live sports streaming. Users can enjoy HD quality, replays, and highlights seamlessly, making it a must-have for sports enthusiasts seeking an immersive viewing experience anytime, anywhere. Overview of Adrenalina Gol In today's digital age, Adrena

    Download
  • Anime Online
    Anime Online

    Video Players & Editors 丨 37.40M

    Elevate your anime viewing experience with Anime Online app where you can easily search and watch trailers for all your favorite anime series. With just a few taps, you can access a wealth of information on different anime titles, allowing you to discover new shows and stay up-to-date on the latest

    Download
  • آهنگ های احمد ولى
    آهنگ های احمد ولى

    Video Players & Editors 丨 81.62M

    Introducing the "AhmadWali" app: Experience the ultimate music collection with the latest and best songs from your favorite artists, all in one place. Enjoy a seamless and immersive music experience with features like free access, lyrics display, background playback, and even control when your phone

    Download
  • Music Player - MP3 Player & EQ
    Music Player - MP3 Player & EQ

    Video Players & Editors 丨 10.46M

    Introducing the Music Player - MP3 Player & EQ! Immerse yourself in superior audio quality with this mobile music playback solution. Seamlessly detect and incorporate music files into your playlist, supporting various formats like mp3 and mp4. Easily organize your music library by albums, artists, s

    Download
  • Adobe Premiere Rush: Video
    Adobe Premiere Rush: Video

    Video Players & Editors 丨 159.83 MB

    Adobe Premiere Rush APK combines creativity and ease. This Adobe-created software revolutionizes mobile video editing. It's a powerhouse with desktop editing tools' precision. Adobe Premiere Rush combines simplicity and strength, making it vital for storytellers, vloggers, and anybody who wants to c

    Download
  • OREO TV
    OREO TV

    Video Players & Editors 丨 10.20M

    Experience a world of entertainment with OREO TV, your go-to app for diverse TV series and movies across various genres. With a wealth of captivating episodes and programs, it keeps you engaged and entertained. Regular updates ensure you never miss out on the latest releases, making it an essential

    Download